CXCL14(1-58) (Human)
$360.00
- Quantity: 100μg
- Catalog #: 045-28
- Purity: Purity ≥95%
- Molecular Weight: 6817.09 Da
- Form & Storage: Lyophilized powder | Store desiccated at -20°C
🔥 Exclusive Crypto Offer
Get an INSTANT 15% DISCOUNT when you pay with Bitcoin, Ethereum, Dogecoin, Bitcoin Cash, XRP, Solana, or USDT.
⚡ Don't have crypto? Buy it here in 5 minutes with easy guidance.
💡 Pro Tip: You can also pay with cryptocurrency using your verified Cash App or PayPal account for a fast and secure checkout!
CXCL14(1-58) (Human)
The CXCL14(1-58) (Human) (Catalog #045-28) is a research reagent supplied by Phoenix Peptide under our specialized Peptides category. This item is offered at a regular price of $360 for a package size of 100μg.
Biochemical & Structural Specifications
Amino Acid Sequence: SKCKCSRKGPKIRYSDVKKLEMKPKYPHCEEKMVIITTKSVSRYRGQEHCLHPKLQST
Molecular Weight: 6817.09 Da
Purity Level: Purity ≥95%
Validation: Exhibits correct M.W.
Storage, Handling & Operational Notes
Vial Contents: Each vial contains 100 µg of NET peptide.
Storage Guidelines: Store in dry form at 0-5°C.
Related Research Products & Support
For complementary laboratory workflows, explore related items in our catalog: iDiLeu-d9, iDiLeu-d6, and iDiLeu-d3 available through Phoenix Peptide. Guaranteed for quality assurance and analytical precision.
| Specification / Feature | Details |
|---|---|
| Catalog Number | 045-28 |
| Quantity | 100μg |
| Sequence | SKCKCSRKGPKIRYSDVKKLEMKPKYPHCEEKMVIITTKSVSRYRGQEHCLHPKLQST |
| Molecular Weight | 6817.09 |
| Purity | Purity ≥95% |
| Storage | Store in dry form at 0-5°C. |
| Appearance | White powder |
| Contents | Each vial contains 100 µg of NET peptide. |
| Category | Peptides |
| Price / Unit | $360 |
| Validation | Exhibits correct M.W. |
| Disulfide Bridge | Disulfide Bonds : Cys3-Cys29, Cys5-Cys50 |
Only logged in customers who have purchased this product may leave a review.
Reviews
There are no reviews yet.